PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000147309
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 551aa    MW: 59763 Da    PI: 4.7636
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000147309genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.3e-173986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
    MDP0000147309 39 KGPWTSAEDTILVEYVNRHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding51.62.2e-1692135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+ l+v++++++G++ W++ a++++ gRt++++k++w++
    MDP0000147309  92 KGAFTPDEERLIVELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.493486IPR017930Myb domain
SuperFamilySSF466899.73E-3038133IPR009057Homeodomain-like
SMARTSM007171.8E-143888IPR001005SANT/Myb domain
PfamPF002493.4E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-234093IPR009057Homeodomain-like
CDDcd001676.09E-114186No hitNo description
PROSITE patternPS0017505463IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129426.1287141IPR017930Myb domain
SMARTSM007171.3E-1691139IPR001005SANT/Myb domain
PfamPF002492.8E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2594140IPR009057Homeodomain-like
CDDcd001674.58E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MSRTTNESED GMLYKDQIDS PLMDESNGGS GNGGIVLKKG PWTSAEDTIL VEYVNRHGEG  60
NWNAVQKHSG LFRCGKSCRL RWANHLRPNL KKGAFTPDEE RLIVELHAKM GNKWARMAAH  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP EVCLQALQES QQGQSSGGIN GADGAHNDSM  180
QANSFEIPDV VFDSLKGNNC VLPYVPELPD ISPGGMLMKG LGSSPYCGFM SPTMHRQKRL  240
RESTALFSTS GGSFKNGFPQ FDQFQNDTCD KIARTVGFPF PHDPDPTIPL SFGVIQGSHS  300
LSNGNSSASK PTTGAVKPEL PSLQYPETDL GSWSTSPPPP LLESVDAFIQ SPPXVGTFES  360
DCTSPRNSGL LDALLHEAKT LSSANNHSSE KSSNSSSVTP GDVAESSNLN ICETEWEEYR  420
DPISPLGHSA TSLFNECTPI SASGSSLDEP PPAETFTGCN VESELVDQAW TPDTERETAL  480
QLDYTRPDAI LASEWFGNSM HESIASLLGD DLAAECKHLA SGSPTSNQGL GFSSCPWNTM  540
LPFCEMSAQH P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31371405107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.164070.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008375384.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_008375383.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLM5X3T10.0M5X3T1_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-122myb domain protein 33